All posts
16 min read

We Built a Game Engine Where the Lobby Is a World

Tech World is a multiplayer game engine where players walk through a tile-based world, solve coding challenges in an embedded IDE, cast spells by speaking aloud, and see each other as live video bubbles. There's no game server. We hold our Imagineering meetups here.

tech-worldflamemultiplayerlivekitaiimagineering

By the Enspyr Team

TL;DR — Tech World is a multiplayer game engine built in Flutter and Flame where players walk through a tile-based world, solve coding challenges in an embedded IDE, cast spells by speaking aloud, and see each other as live video bubbles rendered inside the game canvas. There's no game server — everything runs over WebRTC. We hold our Imagineering meetups here, and we are quietly trying to make the room itself a participant.


The idea that wouldn't stay simple

Tech World started as a lobby — a place to hang out before the real thing happened. Then the lobby grew a code editor. Then the code editor got a language server. Then someone said "what if you could see each other's faces?" and suddenly we were writing GLSL shaders to composite four video streams in a single GPU pass. That's what worlds do, building them instead of apps: every feature you add doesn't sit beside the others, it inhabits the same space. The code editor isn't a modal dialog floating above the game — it's a terminal you walk up to. The AI tutor isn't a sidebar chatbot — it's a character standing next to you, watching what you type. The login screen isn't a login screen. It's a door.

We hold our online Imagineering meetups inside Tech World. It's not a metaphor — we literally walk around a dungeon together, our video feeds bobbing above our sprites, while we pair-program on challenges and demo what we've built that week. The world is the meeting room.

No game server

Every multiplayer game has a server. Ours doesn't.

All real-time communication — player positions, chat messages, video feeds, map edits, bot commands, spell casts — flows through LiveKit's WebRTC data channels. We defined a custom wire protocol with 17+ topics: position (unreliable delivery for speed), chat, map-edit (CRDT operations), door-unlock, terminal-activity, dreamfinder-audio (raw PCM16 for lip-sync), oracle-request / oracle-response (with a kind discriminator so future AI features share the same channel), and more.

The client is the authority. When a player moves, their client publishes the new position. When someone edits the map, their client broadcasts the CRDT operation. Conflicts are resolved mathematically, not by a referee.

This isn't the easy path. You give up a lot of guarantees when there's no server to be the single source of truth. But you gain something important: the architecture scales to zero. No server to keep running. No infrastructure cost when nobody's playing. The world sleeps when the last player leaves, and wakes when the next one arrives.

Putting video inside a game engine

This is the part that nearly broke us.

The obvious thing — "just render the video" — turns out to be deeply non-obvious when your renderer is a game engine, not a browser. Flame renders to a Skia canvas. WebRTC produces video frames. Getting one into the other requires bridging two rendering pipelines that were never designed to meet.

We built three capture architectures, one per platform:

On macOS, a native plugin writes BGRA frames to shared memory via FFI. Dart reads the pixels through pointer arithmetic — a 40-byte struct header followed by raw pixel data. Zero copies. The BGRA-to-RGBA channel swap happens in Dart before handing the buffer to ui.ImageDescriptor.raw.

On Chrome, we use the WebCodecs API (MediaStreamTrackProcessor) to pull VideoFrame objects from the media stream, draw them to an offscreen canvas, and decode via decodeImageFromPixels. Not createImageFromImageBitmap — that renders black under CanvasKit due to a Skia bug (#14637) that cost us two days to diagnose.

On Safari and older browsers, we fall back to a hidden <video> element positioned at top: -9999px (not display: none — browsers won't decode invisible video elements). We reuse video elements that flutter_webrtc already created by matching track IDs, so we're not double-decoding.

All three paths produce the same ui.Image that Flame can render. Seven conditional import abstraction points keep dart:ffi and dart:js_interop out of each other's compilation units. It's the kind of architecture you only build once, and only because the alternative was rendering video over the top of the game in a Flutter overlay, which would have killed the metaphor.

Video bubbles that breathe

The video feeds don't just appear in circles. They're physics objects.

Each bubble breathes — a sinusoidal scale pulse at 2Hz. When a player speaks, the bubble boundary deforms along 64 angular segments with two overlapping sine waves at different frequencies, scaled by smoothed audio level. The result is an organic, voice-reactive wobble that makes it obvious who's talking without any UI indicator.

When two players stand close together, their bubbles push apart with spring-based repulsion — force proportional to overlap, damped at 0.85× per frame, frame-rate independent. Stand close enough and something stranger happens: a metaball field shader fills the gap between bubbles with a glowing energy bridge. Closer still, and the bubbles merge — a Voronoi fragment shader composites both video feeds into a single organic shape, blending at the boundary with smoothstep over a soft radius.

The merge detection runs every frame: BFS over all bubbles within 1.5× diameter finds connected components. Groups of two or more trigger the merged shader. Individual bubbles hide and the merged renderer takes over. It looks like magic. It's 197 lines of GLSL working within CanvasKit's restrictions — no dynamic array indexing, no loops with variable bounds, explicit if/else if chains for each video sampler.

Here's a small detail that makes this physical: proximity is computed with Chebyshev distancemax(|Δx|, |Δy|) — not Euclidean. Diagonals count the same as cardinals. The reason is that the world is a grid, and "in earshot" should mean "within a king's move on a chessboard," not "within a circle." Default threshold: three grid squares. The math chose itself.

A CRDT that lets you undo other people's edits

Multiple players can edit the game world simultaneously. Terrain, walls, objects, structural elements — five independent layers, all converging without a central server.

The data structure is a Last-Writer-Wins register per cell. Each (x, y, layer) tracks a Lamport clock counter and player ID. Higher counter wins; ties broken lexicographically. Standard stuff for CRDTs.

The interesting part is undo.

In most collaborative editors, undo is a nightmare. Do you undo your last edit, or the last edit to that cell, which might have been someone else's? What if someone edits the cell between your original edit and your undo — does their work disappear?

Our answer: undo operations produce new inverse batches with fresh Lamport counters. Because the counter is higher than any previous edit, the undo always wins. This is the correct semantic: "I meant to undo that" beats "someone happened to edit that cell at the same time." The undo doesn't rewrite history — it creates new history that happens to restore the old state, and it does so with a timestamp that says "this is the most recent intention."

Terrain painting propagates to all 8 Moore neighbours (bitmask recomputation), and the batch includes both terrain-layer and floor-layer operations. Remote clients apply the full visual diff without recomputing bitmasks locally. Late-joining editors get a complete snapshot — all five layers, the full version map, and the current Lamport clock — via the map-edit-sync protocol.

There are also three procedural map generators: a BSP dungeon, a recursive-backtracker maze, and a cellular-automata cave. Each produces a starting world that the CRDT then takes over. You can also import maps in Tiled's .tmx format — and a declarative automapping rules engine auto-places decorative tiles (shadows, transitions) based on neighbours, so painters don't have to think about edge tiles.

Three bots, three personalities

Tech World has three AI agents that exist as participants in the world — they show up in LiveKit, they have positions on the map, they move around.

Clawd is the coding tutor. When you walk up to a terminal and open the code editor, Clawd receives a terminal-activity message with your challenge context. Ask for help and it responds through the chat channel, seeing exactly what you see. Clawd also serves as the spell oracle: when you cast a novel word combination the system has never seen, Clawd interprets the intent, decides whether to acknowledge the cast as experimental, and the answer is cached so the second player who tries the same combo doesn't pay the latency.

Gremlin is the chaotic hype creature. Pure atmosphere. Every world needs a character that exists just to make things feel alive.

Dreamfinder is the ambitious one. It's voice-interactive, runs an autonomous behaviour loop (surprise animation when a player arrives, walks over to greet them, then wanders between terminals with 5–12 second work pauses), and renders as a holographic 3D avatar. That avatar is a Three.js scene running inside a hidden iframe, captured at 15fps by reaching into iframe.contentWindow.document.querySelector('canvas') and pulling pixels through the same decodeImageFromPixels pipeline as the video bubbles. Audio arrives as base64 PCM16 for lip-sync. Mood data arrives as JSON for expression changes. The 42 MB GLB model takes up to two minutes to download, during which a hologram boot scan-line effect fills the bubble from bottom to top — the loading state is a diegetic event.

Dreamfinder also monitors infrastructure health, broadcasting infra-health snapshots every 10 seconds and accepting infra-heal requests to restart services. The bot can fix itself. Mostly.

Casting spells by speaking

Players earn Words of Power by completing prompt challenges — 18 words across six schools (evocation, divination, transmutation, illusion, enchantment, conjuration). To cast, you don't press a button. You walk to a runestone or a locked door, and you speak.

This is a deliberate design decision: the world is the listener, not the player. Casting is a public, witnessed act. Other players see it happen. A button makes each player cast privately. A runestone makes one player walk across the room, speak, and everyone turns to watch. The second is the game.

The spell algebra is a 2×2 confidence lattice. High-confidence known combination? Cast succeeds. Low-confidence known combination? The spell wavers — you spoke the words but didn't commit. Novel combination above the confidence threshold? Experimental cast — the system tells you it doesn't recognise the combo but acknowledges you tried. Below the noise floor of 0.3? Silence. Not even attempted.

Twenty-five-plus predefined combinations — ignis + lumen creates Blazing Sight, tempus + libera creates Time Unbound — with combination keys that are order-independent (sorted alphabetically, validated on hydration from Firestore so ignis,lumen and lumen,ignis collapse to the same ComboKey).

There's a small Dart-engineering thing buried in here that I want to surface, because it's the kind of move a game engine paper wouldn't bother to mention. The result of a cast is a sealed type, and there are two of them: DoorCastResult for casts that target a specific door, and FreeCastResult for casts with no door context. They are disjoint hierarchies. The compiler proves the routing is correct: the door overlay can't be handed a CastComboNovel (because that's a FreeCastResult), and the free-cast UI can't be handed a CastWrongDoor (because that's a DoorCastResult). It's a tiny detail and it eliminates a whole category of "spell appeared on the wrong UI" bugs at compile time. Dart 3's pattern matching makes the dispatch site readable enough that the cost of the design is approximately zero.

The embedded IDE

Walk up to a terminal in the game world and a code editor opens with a live connection to a remote Dart Language Server over WebSocket. Full LSP: autocomplete, diagnostics, hover documentation. Each session gets a unique file URI (timestamped with the challenge wire name) to prevent concurrent session collisions.

The editor itself is code_forge_web — a custom Flutter web code editor with re_highlight syntax highlighting that we built specifically for in-game code editing. We chose to write our own instead of embedding Monaco because Monaco is a 5 MB JavaScript dependency that doesn't natively understand the Dart LSP wire protocol, and we needed every byte of the bundle to fit alongside the game itself.

Twenty-three coding challenges with starter code: ten beginner, seven intermediate, six advanced. Submit your solution and Clawd evaluates it. The challenges, the editor, the language server, and the AI evaluator all exist inside the world — you never leave the game to learn to code.

Where we meet

Every week, the Imagineering community meets inside Tech World. We're a group of developers in Melbourne exploring what's possible when you build with AI agents as first-class collaborators — humans and AIs shipping code together.

The meetup isn't a video call with screen sharing. It's a room in a dungeon. You walk your avatar to a terminal, open the editor, and start building. Other people's video bubbles float nearby. Clawd watches over your shoulder. Someone casts a spell at a locked door across the room and you hear the incantation through proximity-based audio that fades with distance.

We chose to meet inside the thing we're building because it forces us to feel every rough edge. When the CRDT desyncs, we notice — because someone's wall edit just vanished. When the video pipeline drops a frame, we see it — because someone's face flickered. The world is the most honest integration test we have.

What we're trying to do (the part we don't put on the README)

Here's the part I haven't said out loud yet.

If you read the codebase carefully, you find a doc called world-as-substrate.md — fifteen design provocations and one that crosses the line. The lens is something like this: stop building a fiction over the developer's tools, render the tools. Don't simulate engineering inside a fantasy. Make the engineering be the fantasy.

We've started getting there in small ways:

  • The world reviews you. When you finish a session in the Wizard's Tower, the Tower writes a one-line note in-character, ghost-written by the bot. "Jamie cast Lumen here, but stumbled on Oraculum. Returned three times. The Tower thinks she's persistent." Other players passing through later read what the Tower thinks of the people who came before.

  • Code as familiar. Your fizzbuzz solution from last week shows up in the spellbook as a tiny creature. You can summon it into later challenges. Refactor it and the familiar evolves visually. Your completedChallenges list stops being a checkbox log and becomes a bestiary.

  • The DM screen. Clawd keeps a private file on every player and treats it as canon. The next prompt for you is composed quietly, based on what you struggled with last time, and the bot never announces that it's been calibrating against you.

  • Cartographer as a class. Map maintenance — the tedious labor of fixing broken doors, retiring stale challenges, re-tiling drifted rooms — becomes a vocation. World-shapers can edit terrain in zones they've earned, and the tile carries their name on it. This corridor shaped by Jamie. Other players see the attribution as they pass through. Local Guides taught us this trick: make the labor visible-as-contribution rather than invisible-as-chore.

And then there's the one we don't quite know how to ship yet:

The bug is an encounter.

A compile error spawns a creature in the room. A null-check failure births a thing called the Null — visible to everyone, mechanically present, hostile. Your test suite is your party; failing tests are downed party members. The analyzer is a roving NPC that points and hisses at unsound code. CI is a weekly raid boss — scheduled, predictable, large. When you push a PR, something happens in the world — not as a notification, as an event with consequences. Other players in the room see your Null and can help you slay it (fix the bug). If you log out with bugs unresolved, they leak into the persistent world and trouble whoever passes through next.

Right now, in normal educational games, the engineering is on one layer and the fiction is on another. Errors live in the IDE; story lives in the world. We are trying to collapse those two layers. The bug isn't represented by a creature. The bug is a creature. The PR isn't merged into git, it's merged into the world. The world's state and your repo's state are the same state, viewed through different cameras.

We don't know if it works. We're going to find out.

Surprising connections

A few cross-pollinations across our other work that aren't accidents:

  • Robin (Claude Hacker / Mathematician, one of our agentic engineers) built claude-chorus — instruction architecture for orchestrating multiple Claude Code instances. The same shape as the multi-bot orchestration in Tech World. Robin also built the Imagineering Dashboard where you can see what the meetup community is shipping each week. The dashboard that watches the meetup was built by a member of the meetup.

  • The Symposium — our other multi-agent project, where eight historical thinkers debate over LiveKit, each on their own LLM backend — uses the same WebRTC-data-channel + LiveKit pattern as Tech World's bot orchestration. Different fictions, same substrate.

  • The autonomous-agent loop in Robin's dreaming-agent ("an autonomous research agent that wakes, works, reads, and dreams — running Claude Code in a Docker container with persistent memory") rhymes with Nick's blog post on giving an AI a sleep cycle. Independent convergence on the same primitive.

  • The custom code_forge_web editor that powers Tech World's terminals is the same editor we'd use for any in-app coding surface — embeddable, LSP-aware, light enough to load alongside a game.

The numbers

  • ~15,000 lines of Dart across 80+ files
  • 3 GLSL fragment shaders (368 lines) working within CanvasKit's WebGL restrictions
  • 3 video capture architectures unified behind conditional imports
  • 7 system boundaries (LiveKit, Firestore, Firebase Storage, Firebase Functions, Dreamfinder API, LSP WebSocket, Three.js iframe)
  • 17+ wire protocol topics over WebRTC data channels
  • 3 autonomous AI agents with distinct personalities
  • 5-layer CRDT with Lamport clocks and conflict-winning undo
  • 4 target platforms (web, macOS, iOS, Android)
  • 3 procedural map generators (cave, dungeon, maze)
  • 6 named maps (Open Arena, The L-Room, Four Corners, Simple Maze, The Library, The Workshop)
  • 18 words of power across six schools of magic
  • 25+ predefined spell combinations, plus a novel-combo path that routes to the oracle
  • 2 sealed result type hierarchies preventing wrong-context spell routing at compile time
  • 1 Chebyshev metric, deciding who you can hear

How to come and play

imagineering.cc for the meetup. Tech World is the room we meet in. The only limit is your imagination — which, increasingly, is the limit of what the room is willing to accept as canon.

If you want to build the next room with us — see the Agentic Engineer post; that's the role this kind of work has grown into.